Tanks Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

745 results found for tanks

artillerymilitaryukrainian forceswartankmissilearmykremlinputinfighter jet
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"tanks"
Footage

MOSCOW, RUSSIA - MAY 07, 2019: Aerial view of tanks column leaving military base to have a trial run for military parade devoted to Victory Day

Tanks with soldiers military trainings. Driving in dust, close-up. Withdraw troops to defend border. Armored vehicle driving at dust clouds

An aerial view over hundreds of military armored tanks ready to be moved to the front line of the war.

Tanks firing their guns

Two heavy Russian tanks are moving at high speed along the roads of the polygon.

MOSCOW, RUSSIA - MAY 07, 2019: Aerial shot of trial run of military parade, column of tanks with soldiers setting off

Strategic military war training with armored tanks on battlefield area. Army military machinery warfare vehicles ride on dusty sand road

Ukraine - destroyed during the war russian military equipment

Military tank in movement on a dirt ground terrain. Aerial View

Sewage farm. Static aerial photo looking down onto the clarifying tanks and green grass.

A convoy of military armored tanks on the back of flatbed trucks, waiting along the roadside for the authorization to proceed.

Military tank in movement on a dirt ground terrain. Aerial View

Tanks and Paladins Mechanized Live Fire

Soldiers OPFOR Position Attacked by US Armor tank

Tanks drive aerial. Army training. Military armored machine. National defense. Power demonstration at dry desert field. Vehicle riding at

U.S. Marines and Royal Canadian Infantry Regiment conduct a mechanized assault

Two tanks successfully overcome a deep water obstacle at the training ground.

Burnt russian military equipment near the road during the war in Ukraine

Flying over the row of tanks and armoured vehicles in firing range before playwar

NEW

Industrial Oil Refinery at dusk with storage tanks, smokestacks, cityscape, cloudy sky

NEW

An aerial view showcasing an illuminated oil refinery operating at night with a cityscape backdrop

Military tank in movement on a dirt ground terrain. Aerial View

Consequences of the war in Ukraine - destroyed Russian military equipment

Armored military war machinery gunners on battlefield area. Tanks machines drive sandy dusty road on training demonstration. Combat defense

Military tank in movement on a dirt ground terrain. Aerial View

Close-up parts of destroyed military vehicles with suburban road and green forest at background. Ruined burnt down tanks in Ukraine in war zone. Invasion and hope concept.

Khreschatyk street, exposition of captured, destroyed and burnt russian military equipment, artillery and tanks. Passers by look at war crimes proof. Independence day. KYIV, UKRAINE - 24 AUGUST 2022

Belarus, Minsk - June 30, 2022: Fight of the Red Army against the fascist invaders with tanks and equipment near the village

Exercise Cold Response 2014

Large military transport aircraft flying together with fighter jet behind. The United States Air Force training day at the base in

Paladin tank Firing gun

NEW

A dramatic sequence highlights a tanks power in an urban setting

Set of tanks with oil and fuel transport by rail

NEW

Observing an Industrial Refinery illuminated during the night from an aerial perspective

Military border protection, tanks ride on rural road, gray dust from sand. Military exercise at training ground. Army armored transport

Exploded military equipment during the war in Ukraine

Soldiers on military army heavy machinery on war desert battlefield. Armored combat tanks machines drive on heavy warfare vehicles

Group of tanks top down aerial view closeup. Strategic military army training. Armor camouflage transport troops. Warfare demonstration

An aerial view over military armored tanks moving in convoy towards the front line of the battlefield.

Gaza, March 30, 2019. IDF tanks lined up in combat formation near the border

DONETSK, UKRAINE- 09 May 2015: column of tanks at the victory parade

Consequences of the war in Ukraine - destroyed russian military equipment

Military armored tanks immobilized and unable to move due to heavy snow and freezing conditions.

A close-up view of multiple Leopard 2 military armored tanks, mothballed and preserved in an unknown warehouse for potential future deployment.

Gaza, March 30, 2019. IDF tanks lined up in combat formation near the border

Military tank in movement on a dirt ground terrain. Aerial View

Royal Danish Army Leopard 2 tanks at Grafenwoehr, Germany

Armored tanks on battlefield aerial. Military training. War machines at sand field. National protect and defence. Armor camouflage transport