Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,712 results found for hug

lovehug friendsfamilyhandshakefriendshappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Embracing Love: Real Emotions, Positive Atmosphere

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Couple is hugging. Hands of man and woman. Give more hugs.

the bride and groom walking in the Park in the summer. kiss and hug

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Close-up of woman giving a warm hug to a man outdoors

Medium Shot - Two men greet and hug each other at a park - shot on RED

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Against the background of the orange sunset sky Silhouettes of woman training and playing with her dog during amazing sunset

Portrait of couple hands, sitting on sofa at home in the living room.

Couple embracing after conflict, showing support and forgiveness in living room

Family Hiking: Heartwarming Moments in Nature

A Joyful Evening on the Beach: Couple Embracing

Happy couple hugging in the city, slow motion, shot at 60fps

Loving couple sharing affectionate moment while strolling together

Couple embracing at home

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

Loving couple embracing outdoors

Senior couple hugging in the city during sunset, 120fps

Sunset Silhouette of Couple Embracing at Beach

Hindu man and African American woman embrace in greeting

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Group of Young People Embrace

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Siblings sharing a loving moment on the couch

Loving couple sharing affectionate moment while strolling together

Woman received a teddy bear

Cool Couple Laughing and hugging In Front Of Beach In autumn

Couple at the meadow

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Girl hugging a guy, close-up of hands interlocking on the back of a boyfriend

Father hugs his son on the field at sunset. Slowmo

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

Senior woman squatting and hugging granddaughter outdoors on bench in park.

Couple Greeting Each Other With Hug As They Meet In Coffee Shop

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Joyful couple's encounter in the fall park

Sweet Moment: Young Girl Embraces Grandmother with a Smile

A Couple Embraces in a Stunning Sunset

Family enjoying autumn walk in the park. Slow motion.

Reunion of diverse friends in apartment, smiling and talking

Medium shot of two senior men in hats standing in pedestrian street on warm day, hugging each other and patting on the shoulders

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Boy tightly embracing his mother