Hug Stock Footage: Royalty-Free Video Clips

Royalty-free Stock Footage Clips

Footage

9,687 results found for hug

lovehug friendshandshakefriendsfamilyhappycouple hugsadsmilefamily hug
Clear Filters

Media Type

Resolution

Frame Rate

Duration

0:001:00+

Media Details

Usage Rights

Categories

"hug"
Footage

Rear view of adult daughter hugging happy senior mother indoors at home.

Medium Shot - Two people hug each other - Slow Motion - shot on RED

Candid Loving Older Couple Hugging. Senior Husband Embracing Wife in front of window

Embracing Love: Real Emotions, Positive Atmosphere

Close-up of woman giving a warm hug to a man outdoors

Couple is hugging. Hands of man and woman. Give more hugs.

Medium Shot - Two men greet and hug each other at a park - shot on RED

Father lifting child in air over scenic sunset sky. Daddy and daughter playing together, side view, slow motion.

Young people celebrate birthday with dance and hugs. Emotional moment of togetherness.

Tired parent dealing with energetic child on the couch. Slow motion shot.

Portrait of couple hands, sitting on sofa at home in the living room.

Spending Time Together: Three Friends Smiling on Bed (Slow Motion)

A Joyful Evening on the Beach: Couple Embracing

Couple embracing after conflict, showing support and forgiveness in living room

Loving couple sharing affectionate moment while strolling together

Close up view of cheerful long-haired woman strongly hugs her boyfriend. Romantic date, true feelings, real emotions. Taking care, romance. Love story

Happy Muslim Family With Kid Girl Hugging Posing In Kitchen

Active retired old men and leisure, two senior black brothers talking and hugging in park. Sequence

Loving couple embracing outdoors

Slowmo of man working on laptop in living room while his daughter giving him handmade postcard on Fathers Day

Sunset Silhouette of Couple Embracing at Beach

Senior couple hugging in the city during sunset, 120fps

Couple embracing at home

Group of Young People Embrace

Family Fun at Sunset: Parents and Child Enjoying Time Together in the Park

Happy couple hugging in the city, slow motion, shot at 60fps

Cool Couple Laughing and hugging In Front Of Beach In autumn

Two joyful friends embracing in a park. Diverse women in vibrant outfits enjoy a laughter-filled gathering.

Couple at the meadow

Man and woman hugging. Couple standing indoors. Interesting facts about hugs.

NEW

Young boy lovingly hugging baby sibling in mother’s arms during a tender family moment on the couch, displaying strong sibling bond and affection, monochrome video.

Overjoyed ecstatic friendly professional multiracial team business people group bonding celebrating triumph good teamwork result success together standing in office, rewards and achievements concept

Amazing close up portrait of cheerful caucasian woman with freckles laughing with closed eyes hugging with her man against the sunset outside.

Three friends embracing each other. Heartwarming bond. Meeting in slow motion.

Portrait Of Two Sisters Sitting On Sofa At Home Smiling Into Camera

Emotional girlfriend hugs boyfriend intimately. - Slow Motion - shot on RED

Medium shot of affectionate elderly Caucasian woman hugging son or grandson and talking to him

Family enjoying autumn walk in the park. Slow motion.

Young couple embraces in nature, practicing social distancing. Post-quarantine walk together. Love in the open air. Covid-19 concept.

Close up of happy senior woman getting gift from friend during celebration outdoors on patio

A Couple Embraces in a Stunning Sunset

Concept of love and friendship. Woman and her border collie dog holding hands and looking at each other. Touching moment of sincerity. Dogs are best friends. Relationship between human and animal.

Two women of different backgrounds sharing a warm embrace

Happy couple embracing on beach, stormy day, 240fps

Medium Shot - Two friends embrace - shot on RED

Supportive Family: Overcoming Grief Together

Two happy women hug each other when meeting after long separation

Couple strolls in the park